PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000145757
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 361aa    MW: 40769.1 Da    PI: 6.1026
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000145757genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.34.9e-201461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv++++q+G g+W++ +r  g++R++k+c++rw +yl
    MDP0000145757 14 KGPWTPEEDQKLVQYIEQHGHGSWRALPRLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.31.3e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ +++++  lG++ W++Ia ++  gRt++++k++w+++l
    MDP0000145757  67 RGKFSEEEEQTILHLHSILGNK-WSAIATHLD-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.967961IPR017930Myb domain
SuperFamilySSF466891.24E-3111108IPR009057Homeodomain-like
SMARTSM007173.0E-161363IPR001005SANT/Myb domain
PfamPF002495.6E-181461IPR001005SANT/Myb domain
CDDcd001674.55E-131661No hitNo description
PROSITE profilePS5129426.63562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2665117IPR009057Homeodomain-like
SMARTSM007179.7E-1666114IPR001005SANT/Myb domain
PfamPF002491.7E-1567112IPR001005SANT/Myb domain
CDDcd001678.36E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MGRSPCSDES GLKKGPWTPE EDQKLVQYIE QHGHGSWRAL PRLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SEEEEQTILH LHSILGNKWS AIATHLDGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHQPRT DLFSSLSQLL ALANLQDLMQ QYQPADHINQ HAATLQADQA VQLSKLQYMQ  180
HLLQSVPYTS NTDNYRQNRS TEMEMEMDDQ AFNLLNSLNI SPIKENPNFN SPQLENPSSF  240
SDHGYGRNSS QPLHHHQTQL PYDLADPQVP FSSLPSLNNS DHEMGQGSNF KMVSSQENNL  300
PDESPWFNNL LSPTAPSIPP SISPTSNVPG DACCSSSSYG GRSSNSSSYW PELFLEDANY  360
G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008383937.10.0PREDICTED: myb-related protein 315-like
TrEMBLM5XKW70.0M5XKW7_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s17080.11e-139(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.13e-93myb domain protein 93